PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.006170.1
Common NameCsa_5G425400, LOC101213028
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 301aa    MW: 33770.9 Da    PI: 5.113
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.006170.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  +   G  +W+++++  g+ R++k+c++rw +yl
   Cucsa.006170.1 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.64.4e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d++ qlG++ W++Ia++++ gRt++++k++w+++
   Cucsa.006170.1  71 SEYEEKMVIDLHSQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.55961IPR017930Myb domain
SuperFamilySSF466897.11E-2711108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002492.7E-141461IPR001005SANT/Myb domain
CDDcd001671.47E-81661No hitNo description
PROSITE profilePS5129425.43462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2464117IPR009057Homeodomain-like
SMARTSM007176.3E-1466114IPR001005SANT/Myb domain
PfamPF002497.8E-1471111IPR001005SANT/Myb domain
CDDcd001671.68E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRQPCCDKI GLKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHSQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPQTHKSIS QTSDDTHLTD KDKRQSSQPP SPPKELKKEV TAAKTDIIET NITDLIMDGF  180
CTEEVPLIEP HEILVPCASS SSTTSTSYSS SSSYSYSSFS SNPESAANLL QDLVNEFPEF  240
EWPNICEENG IVEEGLLEDD FGSSWDFMVN NYEGGNANNF GNDPFVGLEL ENSQSWVYGL  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818930.0LN681893.1 Cucumis melo genomic scaffold, anchoredscaffold00055.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140299.10.0PREDICTED: protein ODORANT1
TrEMBLA0A0A0KRP90.0A0A0A0KRP9_CUCSA; Uncharacterized protein
STRINGPOPTR_0004s08480.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.13e-93myb domain protein 43
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]